HORDB

ID: hor006565
Uniprot ID: Q09626
Protein name: Probable insulin-like peptide beta-type 1
Gene name: ins-4
Organism: Caenorhabditis elegans
Family: Insulin family
Source: Animal
Expression: Expressed by ASI and ASJ sensory neurons and weakly by ventral cord motor neurons.
Disease: NA
Comments: NA
Taxonomy: Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007165 signal transduction; GO:0008582 regulation of synaptic assembly at neuromuscular junction; GO:0040024 dauer larval development; GO:1905910 negative regulation of dauer entry
GO CC: GO:0005576 extracellular region

Sequence: VPAGEVRACGRRLLLFVWSTCGEPCTPQEDMDIATVCCTTQCTPSYIKQACCPEK
Length: 55(52-106)
Propeptide: MFSFFTYFLLSALLLSASCRQPSMDTSKADRILREIEMETELENQLSRARRVPAGEVRACGRRLLLFVWSTCGEPCTPQEDMDIATVCCTTQCTPSYIKQACCPEK
Signal peptide: MFSFFTYFLLSALLLSASC
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Probable insulin-like peptide which negatively regulates synapse development at the neuromuscular junctions (PubMed:23665919). Probably acts as a daf-2/InsR agonist ligand to prevent dauer formation under optimal environmental conditions (PubMed:24671950)
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006565_AF2.pdb

hor006565_ESM.pdb

Mass:	697439	Formula:	C254H408N70O80S9
Absent amino acids:	HN	Common amino acids:	C
pI:	4.77	Basic residues:	5
Polar residues:	20	Hydrophobic residues:	15
Hydrophobicity:	-1.64	Boman Index:	-7080
Half-Life:	100 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	63.82
Instability Index:	8107.45	Extinction Coefficient cystines:	7490
Absorbance 280nm:	138.7

PubMed ID: 9851916
Title: Genome sequence of the nematode C. elegans: a platform for investigating biology.
PubMed ID: 9548970
Title: New insulin-like proteins with atypical disulfide bond pattern characterized in Caenorhabditis elegans by comparative sequence analysis and homology modeling.
PubMed ID: 23665919
Title: Attenuation
PubMed ID: 24671950
Title: